SLC16A4 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A14818
Article Name: SLC16A4 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A14818
Supplier Catalog Number: A14818
Alternative Catalog Number: ABB-A14818-100UL,ABB-A14818-20UL,ABB-A14818-500UL,ABB-A14818-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: MCT4, MCT5, SLC16A4
Predicted to enable monocarboxylic acid transmembrane transporter activity. Predicted to be involved in monocarboxylic acid transport. Predicted to be located in membrane. Predicted to be integral component of plasma membrane.
Clonality: Polyclonal
Molecular Weight: 54kDa
NCBI: 9122
UniProt: O15374
Purity: Affinity purification
Sequence: TFPLLMTYTICFAIFAGGYLALILPVLVDLCRNSTVNRFLGLASFFAGMAVLSGPPIAGWLYDYTQTYNGSFYFSGICYLLSSVSFFFVPLAERWKNSLT
Target: SLC16A4
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Rat. Shipping: Ice Bag
Western blot analysis of lysates from SW480 cells, using SLC16A4 Rabbit pAb (A14818) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.