LPAR2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A14819
Article Name: LPAR2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A14819
Supplier Catalog Number: A14819
Alternative Catalog Number: ABB-A14819-100UL,ABB-A14819-20UL,ABB-A14819-500UL,ABB-A14819-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: EDG4, LPA2, EDG-4, LPA-2, LPAR2
This gene encodes a member of family I of the G protein-coupled receptors, as well as the EDG family of proteins. This protein functions as a lysophosphatidic acid (LPA) receptor and contributes to Ca2+ mobilization, a critical cellular response to LPA in cells, through association with Gi and Gq proteins. An alternative splice variant has been described but its full length sequence has not been determined.
Clonality: Polyclonal
Molecular Weight: 39kDa
NCBI: 9170
UniProt: Q9HBW0
Purity: Affinity purification
Sequence: FVVCWTPGQVVLLLDGLGCESCNVLAVEKYFLLLAEANSLVNAAVYSCRDAEMRRTFRRLLCCACLRQSTRESVHYTSSAQGGASTRIMLPENGHPLMDST
Target: LPAR2
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human. ResearchArea: Epigenetics Nuclear Signaling,Signal Transduction,G protein signaling,G-Protein-Coupled ReceptorsGPCR. Shipping: Ice Bag
Western blot analysis of lysates from HL-60 cells, using LPAR2 Rabbit pAb (A14819) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.