DCTN2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A14841
Article Name: DCTN2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A14841
Supplier Catalog Number: A14841
Alternative Catalog Number: ABB-A14841-20UL,ABB-A14841-100UL,ABB-A14841-1000UL,ABB-A14841-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: RBP50, DCTN50, HEL-S-77, DYNAMITIN, DCTN2
This gene encodes a 50-kD subunit of dynactin, a macromolecular complex consisting of 10-11 subunits ranging in size from 22 to 150 kD. Dynactin binds to both microtubules and cytoplasmic dynein. It is involved in a diverse array of cellular functions, including ER-to-Golgi transport, the centripetal movement of lysosomes and endosomes, spindle formation, chromosome movement, nuclear positioning, and axonogenesis. This subunit is present in 4-5 copies per dynactin molecule. It contains three short alpha-helical coiled-coil domains that may mediate association with self or other dynactin subunits. It may interact directly with the largest subunit (p150) of dynactin and may affix p150 in place. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
Clonality: Polyclonal
Molecular Weight: 44kDa
NCBI: 10540
UniProt: Q13561
Purity: Affinity purification
Sequence: VLDQVEARLQSVLGKVNEIAKHKASVEDADTQSKVHQLYETIQRWSPIASTLPELVQRLVTIKQLHEQAMQFGQLLTHLDTTQQMIANSLKDNTTLLTQVQTTMRENLATVEGNFASIDERM
Target: DCTN2
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Cell Cycle,Centrosome,Cytoskeleton,Motor Proteins,Neuroscience,Neurodegenerative Diseases. Shipping: Ice Bag
Western blot analysis of various lysates, using DCTN2 Rabbit pAb (A14841) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.