CYTH4 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A14875
Article Name: CYTH4 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A14875
Supplier Catalog Number: A14875
Alternative Catalog Number: ABB-A14875-20UL,ABB-A14875-100UL,ABB-A14875-1000UL,ABB-A14875-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: CYT4, PSCD4, DJ63G5.1, cytohesin-4, CYTH4
This gene encodes a member of the PSCD family of proteins, which have an N-terminal coiled-coil motif, a central Sec7 domain, and a C-terminal pleckstrin homology (PH) domain. The coiled-coil motif is involved in homodimerization, the Sec7 domain contains guanine-nucleotide exchange protein (GEP) activity, and the PH domain interacts with phospholipids and is responsible for association of PSCDs with membranes. Members of this family function as GEPs for ADP-ribosylation factors (ARFs), which are guanine nucleotide-binding proteins involved in vesicular trafficking pathways. This protein exhibits GEP activity in vitro with ARF1 and ARF5, but is inactive with ARF6. Alternatively spliced transcript variants have been found for this gene.
Clonality: Polyclonal
Molecular Weight: 46kDa
NCBI: 27128
UniProt: Q9UIA0
Purity: Affinity purification
Sequence: MDLCHPEPAELSSGETEELQRIKWHRKQLLEDIQKLKDEIADVFAQIDCFESAEESRMAQKEKELCIGRK
Target: CYTH4
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Mouse,Rat. ResearchArea: Signal Transduction. Shipping: Ice Bag
Western blot analysis of various lysates using CYTH4 Rabbit pAb (A14875) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.