LGALSL Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A14880
Article Name: LGALSL Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A14880
Supplier Catalog Number: A14880
Alternative Catalog Number: ABB-A14880-20UL,ABB-A14880-100UL,ABB-A14880-500UL,ABB-A14880-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: GRP, HSPC159, LGALSL
Predicted to enable carbohydrate binding activity.
Clonality: Polyclonal
Molecular Weight: 19kDa
NCBI: 29094
UniProt: Q3ZCW2
Purity: Affinity purification
Sequence: MAGSVADSDAVVKLDDGHLNNSLSSPVQADVYFPRLIVPFCGHIKGGMRPGKKVLVMGIVDLNPESFAISLTCGDSEDPPADVAIELKAVFTDRQLLRNSCISGERGEEQSAIPYFPFIPDQPFRVEILCEHPRFRVFVDGHQLFDFYHRIQTLSAIDTIKINGDLQITKLG
Target: LGALSL
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Mouse. ResearchArea: Cell Biology Developmental Biology. Shipping: Ice Bag
Western blot analysis of lysates from mouse brain, using LGALSL Rabbit pAb (A14880) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.