GOLGA7 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A14888
Article Name: GOLGA7 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A14888
Supplier Catalog Number: A14888
Alternative Catalog Number: ABB-A14888-100UL,ABB-A14888-20UL,ABB-A14888-1000UL,ABB-A14888-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: GCP16, GOLGA7A, HSPC041, GOLGA3AP1, GOLGA7
Involved in Golgi to plasma membrane protein transport, peptidyl-L-cysteine S-palmitoylation, and protein stabilization. Acts upstream of or within Golgi to plasma membrane transport. Located in Golgi membrane and Golgi stack. Is intrinsic component of Golgi membrane. Part of palmitoyltransferase complex.
Clonality: Polyclonal
Molecular Weight: 16kDa
NCBI: 51125
UniProt: Q7Z5G4
Purity: Affinity purification
Sequence: MRPQQAPVSGKVFIQRDYSSGTRCQFQTKFPAELENRIDRQQFEETVRTLNNLYAEAEKLGGQSYLEGCLACLTAYTIFLCMETHYEKVLKKVSKYIQEQNEKIYAPQGLLLTDPIERGLRVFRLKLPFMKTEA
Target: GOLGA7
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse. Shipping: Ice Bag
Western blot analysis of various lysates using GOLGA7 Rabbit pAb (A14888) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.