GPR173 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A14897
Article Name: GPR173 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A14897
Supplier Catalog Number: A14897
Alternative Catalog Number: ABB-A14897-100UL,ABB-A14897-20UL,ABB-A14897-1000UL,ABB-A14897-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: SREB3, GPR173
This gene encodes a member of the G-protein coupled receptor 1 family. This protein contains 7 transmembrane domains and conserved cysteine residues.
Clonality: Polyclonal
Molecular Weight: 41kDa
NCBI: 54328
UniProt: Q9NS66
Purity: Affinity purification
Sequence: FDVGTYKFIREEDQCIFEHRYFKANDTLGFMLMLAVLMAATHAVYGKLLLFEYRHRKMKPVQMVPAISQNW
Target: GPR173
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse. ResearchArea: Signal Transduction,G protein signaling,G-Protein-Coupled ReceptorsGPCR. Shipping: Ice Bag
Western blot analysis of various lysates using GPR173 Rabbit pAb (A14897) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.