BATF3 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A14906
Article Name: BATF3 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A14906
Supplier Catalog Number: A14906
Alternative Catalog Number: ABB-A14906-20UL,ABB-A14906-100UL,ABB-A14906-500UL,ABB-A14906-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: JDP1, SNFT, JUNDM1, BATF3
This gene encodes a member of the basic leucine zipper protein family. The encoded protein functions as a transcriptional repressor when heterodimerizing with JUN. The protein may play a role in repression of interleukin-2 and matrix metalloproteinase-1 transcription.
Clonality: Polyclonal
Molecular Weight: 14kDa
NCBI: 55509
UniProt: Q9NR55
Purity: Affinity purification
Sequence: MSQGLPAAGSVLQRSVAAPGNQPQPQPQQQSPEDDDRKVRRREKNRVAAQRSRKKQTQKADKLHEEYESLEQENTMLRREIGKLTEELKHLTEALKEHEKMCPLLLCPMNFVPVPPRPDPVAGCLPR
Target: BATF3
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Rat. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors. Shipping: Ice Bag
Western blot analysis of lysates from rat spleen, using BATF3 Rabbit pAb (A14906) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.