ORMDL3 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A14951
Article Name: ORMDL3 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A14951
Supplier Catalog Number: A14951
Alternative Catalog Number: ABB-A14951-20UL,ABB-A14951-100UL,ABB-A14951-500UL,ABB-A14951-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: ORMDL3
Involved in ceramide metabolic process. Acts upstream of or within several processes, including negative regulation of B cell apoptotic process, negative regulation of ceramide biosynthetic process, and positive regulation of protein localization to nucleus. Located in endoplasmic reticulum. Part of SPOTS complex.
Clonality: Polyclonal
Molecular Weight: 17kDa
NCBI: 94103
UniProt: Q8N138
Purity: Affinity purification
Sequence: MNVGTAHSEVNPNTRVMNSRGIWLSYVLAIGLLHIVLLSIPFVSVPVVWTLTNLIHNMGMYIFLHTVKGTPFETPDQGKARLLTHWEQMDYGVQFTASRK
Target: ORMDL3
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse. ResearchArea: Cancer,Endocrine Metabolism,Lipid Metabolism,Neuroscience,Calcium Signaling. Shipping: Ice Bag
Western blot analysis of various lysates using ORMDL3 Rabbit pAb (A14951) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 60s.