NR2C2AP Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A14960
| Article Name: |
NR2C2AP Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: |
ABB-A14960 |
| Supplier Catalog Number: |
A14960 |
| Alternative Catalog Number: |
ABB-A14960-100UL,ABB-A14960-20UL,ABB-A14960-1000UL,ABB-A14960-500UL |
| Manufacturer: |
ABclonal |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
ELISA, WB |
| Species Reactivity: |
Human |
| Immunogen: |
Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: |
Unconjugated |
| Alternative Names: |
TRA16, NR2C2AP |
| Clonality: |
Polyclonal |
| Molecular Weight: |
16kDa |
| NCBI: |
126382 |
| UniProt: |
Q86WQ0 |
| Purity: |
Affinity purification |
| Sequence: |
MTHSLVCPETVSRVSSVLNRNTRQFGKKHLFDQDEETCWNSDQGPSQWVTLEFPQLIRVSQLQIQFQGGFSSRRGCLEGSQGTQALHKIVDFYPEDNNSLQTFPIPAAEVDRLKVTFEDATDFFGRVVIYHLRVLGEKV |
| Target: |
NR2C2AP |
| Application Dilute: |
WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: |
Cross-Reactivity: Human. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors. Shipping: Ice Bag |
|
Western blot analysis of lysates from U-251 MG cells usingNR2C2AP Rabbit pAb (A14960) at1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 90s. |