NR2C2AP Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A14960
Article Name: NR2C2AP Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A14960
Supplier Catalog Number: A14960
Alternative Catalog Number: ABB-A14960-100UL,ABB-A14960-20UL,ABB-A14960-1000UL,ABB-A14960-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: TRA16, NR2C2AP
Located in nucleoplasm.
Clonality: Polyclonal
Molecular Weight: 16kDa
NCBI: 126382
UniProt: Q86WQ0
Purity: Affinity purification
Sequence: MTHSLVCPETVSRVSSVLNRNTRQFGKKHLFDQDEETCWNSDQGPSQWVTLEFPQLIRVSQLQIQFQGGFSSRRGCLEGSQGTQALHKIVDFYPEDNNSLQTFPIPAAEVDRLKVTFEDATDFFGRVVIYHLRVLGEKV
Target: NR2C2AP
Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors. Shipping: Ice Bag
Western blot analysis of lysates from U-251 MG cells usingNR2C2AP Rabbit pAb (A14960) at1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.