SLCO6A1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A14963
Article Name: SLCO6A1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A14963
Supplier Catalog Number: A14963
Alternative Catalog Number: ABB-A14963-100UL,ABB-A14963-20UL,ABB-A14963-500UL,ABB-A14963-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: GST, CT48, OATPY, OATP-I, OATP6A1, SLCO6A1
Predicted to enable sodium-independent organic anion transmembrane transporter activity. Predicted to be involved in sodium-independent organic anion transport. Predicted to be located in plasma membrane. Predicted to be integral component of membrane. Predicted to be integral component of plasma membrane.
Clonality: Polyclonal
Molecular Weight: 79kDa
NCBI: 133482
UniProt: Q86UG4
Purity: Affinity purification
Sequence: VQFAGINEDYDGTGKLGNLTAPCNEKCRCSSSIYSSICGRDDIEYFSPCFAGCTYSKAQNQKKMYYNCSCIKEGLITADAEGDFIDARPGKCDAKCYKLPL
Target: SLCO6A1
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Endocrine Metabolism. Shipping: Ice Bag
Western blot analysis of various lysates using SLCO6A1 Rabbit pAb (A14963) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.