DPPA2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A14966
Article Name: DPPA2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A14966
Supplier Catalog Number: A14966
Alternative Catalog Number: ABB-A14966-20UL,ABB-A14966-100UL,ABB-A14966-500UL,ABB-A14966-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: CT100, PESCRG1, ECAT15-2, DPPA2
Predicted to enable chromatin binding activity. Predicted to be involved in system development. Predicted to act upstream of or within several processes, including lung-associated mesenchyme development, positive regulation of stem cell proliferation, and regulation of histone methylation. Located in nucleoplasm.
Clonality: Polyclonal
Molecular Weight: 34kDa
NCBI: 151871
UniProt: Q7Z7J5
Purity: Affinity purification
Sequence: MSDANLDSSKKNFLEGEVDDEESVILTLVPVKDDANMEQMEPSVSSTSDVKLEKPKKYNPGHLLQTNEQFTAPQKARCKIPALPLPTILPPINKVCRDTLRDWCQQLGLSTNGKKIEVYLRLHRHAYPEQRQDMPEMSQETRLQRCSRKRKAVTKRARLQRSYEMNERAEETNTVEVITSAPGAMLASWARIAARAVQPK
Target: DPPA2
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Stem Cells,Embryonic Stem Cells,Germline Stem Cells. Shipping: Ice Bag
Western blot analysis of various lysates using DPPA2 Rabbit pAb (A14966) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.




* VAT and and shipping costs not included.
Errors and price changes excepted
Availability
ORDER BY EMAIL
Product Guarantee and Expert Support
BIOZOL