SLC5A9 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A14976
Article Name: SLC5A9 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A14976
Supplier Catalog Number: A14976
Alternative Catalog Number: ABB-A14976-20UL,ABB-A14976-100UL,ABB-A14976-500UL,ABB-A14976-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: SGLT4, SLC5A9
Predicted to enable glucose:sodium symporter activity. Predicted to be involved in sodium ion transport. Located in extracellular exosome.
Clonality: Polyclonal
Molecular Weight: 74kDa
NCBI: 200010
UniProt: Q2M3M2
Purity: Affinity purification
Sequence: LGFQDVGWYPGLEQRYRQAIPNVTVPNTTCHLPRPDAFHILRDPVSGDIPWPGLIFGLTVLATWCWCTDQVIVQRSLSAKSLSHAKGGSVL
Target: SLC5A9
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse. ResearchArea: Endocrine Metabolism. Shipping: Ice Bag
Western blot analysis of various lysates using SLC5A9 Rabbit pAb (A14976) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.