HBG1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A14989
Article Name: HBG1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A14989
Supplier Catalog Number: A14989
Alternative Catalog Number: ABB-A14989-20UL,ABB-A14989-100UL,ABB-A14989-1000UL,ABB-A14989-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: HBGA, HBGR, HBG-T2, HSGGL1, PRO2979, HBG1
The gamma globin genes (HBG1 and HBG2) are normally expressed in the fetal liver, spleen and bone marrow. Two gamma chains together with two alpha chains constitute fetal hemoglobin (HbF) which is normally replaced by adult hemoglobin (HbA) at birth. In some beta-thalassemias and related conditions, gamma chain production continues into adulthood. The two types of gamma chains differ at residue 136 where glycine is found in the G-gamma product (HBG2) and alanine is found in the A-gamma product (HBG1). The former is predominant at birth. The order of the genes in the beta-globin cluster is: 5-epsilon -- gamma-G -- gamma-A -- delta -- beta--3.
Clonality: Polyclonal
Molecular Weight: 16kDa
NCBI: 3047
UniProt: P69891
Purity: Affinity purification
Sequence: MGHFTEEDKATITSLWGKVNVEDAGGETLGRLLVVYPWTQRFFDSFGNLSSASAIMGNPKVKAHGKKVLTSLGDATKHLDDLKGTFAQLSELHCDKLHVD
Target: HBG1
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. Shipping: Ice Bag
Western blot analysis of various lysates using HBG1 Rabbit pAb (A14989) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.