BMP10 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A15010
Article Name: BMP10 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A15010
Supplier Catalog Number: A15010
Alternative Catalog Number: ABB-A15010-20UL,ABB-A15010-100UL,ABB-A15010-1000UL,ABB-A15010-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: BMP10
This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate the mature protein, which binds to the activin receptor-like kinase 1 (ALK1) and plays important roles in cardiovascular development including cardiomyocyte proliferation and regulation of heart size, closure of the ductus arteriosus, angiogenesis and ventricular trabeculation.
Clonality: Polyclonal
Molecular Weight: 48kDa
NCBI: 27302
UniProt: O95393
Purity: Affinity purification
Sequence: SPIMNLEQSPLEEDMSLFGDVFSEQDGVDFNTLLQSMKDEFLKTLNLSDIPTQDSAKVDPPEYMLELYNKFATDRTSMPSANIIRSFKNEDLFSQPVSFNGLRKYPLLFNVSIPHHEEVIMAELRLYTLVQRDRMIYDGVDRKITIFEVLESKGDNEGERNMLVLVSGEIYGTNSEWETFDVTDAIRRWQKSGSSTHQLEVHIESKHDEAEDASSGRLEIDTSAQNKHNPLLIVFSDDQSSDKERKEELNEMISH
Target: BMP10
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Rat. ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Growth factors,Wnt -Catenin Signaling Pathway,Immunology Inflammation,Cytokines,NF-kB Signaling Pathway,Cardiovascular,Heart,Cardiogenesis,Hypertrophy. Shipping: Ice Bag
Western blot analysis of lysates from rat heart, using BMP10 Rabbit pAb (A15010) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 15s.