FOXN3 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A15039
- Images (1)
| Article Name: | FOXN3 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A15039 |
| Supplier Catalog Number: | A15039 |
| Alternative Catalog Number: | ABB-A15039-100UL,ABB-A15039-20UL,ABB-A15039-1000UL,ABB-A15039-500UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | CHES1, PRO1635, C14orf116, FOXN3 |
| This gene is a member of the forkhead/winged helix transcription factor family. Checkpoints are eukaryotic DNA damage-inducible cell cycle arrests at G1 and G2. Checkpoint suppressor 1 suppresses multiple yeast checkpoint mutations including mec1, rad9, rad53 and dun1 by activating a MEC1-independent checkpoint pathway. Alternative splicing is observed at the locus, resulting in distinct isoforms. |
| Clonality: | Polyclonal |
| Molecular Weight: | 54kDa |
| NCBI: | 1112 |
| UniProt: | O00409 |
| Purity: | Affinity purification |
| Sequence: | VRPLPITPIGVTAAMRNGITSCRMRTESEPSCGSPVVSGDPKEDHNYSSAKSSNARSTSPTSDSISSSSSSADDHYEFATKGSQEGSEGSEGSFRSHESPSDTEEDDRKHSQKEPKDSLGDSGYASQHKKRQHFAKARKVPSDTLPLKKRRTEKPPESDDEEMKEAAGSLLHLAGIRSCLNNITNRTAKGQKEQKETTKN |
| Target: | FOXN3 |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Mouse. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Cell Biology Developmental Biology,Cell Cycle,Cell cycle inhibitors. Shipping: Ice Bag |
|
|
Western blot analysis of lysates from mouse pancreas, using FOXN3 Rabbit pAb (A15039) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 90s. |
Product Guarantee and Expert Support
