FUT3 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A15058
Article Name: FUT3 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A15058
Supplier Catalog Number: A15058
Alternative Catalog Number: ABB-A15058-20UL,ABB-A15058-100UL,ABB-A15058-500UL,ABB-A15058-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: LE, Les, FT3B, CD174, FucT-III, FUT3
The Lewis histo-blood group system comprises a set of fucosylated glycosphingolipids that are synthesized by exocrine epithelial cells and circulate in body fluids. The glycosphingolipids function in embryogenesis, tissue differentiation, tumor metastasis, inflammation, and bacterial adhesion. They are secondarily absorbed to red blood cells giving rise to their Lewis phenotype. This gene is a member of the fucosyltransferase family, which catalyzes the addition of fucose to precursor polysaccharides in the last step of Lewis antigen biosynthesis. It encodes an enzyme with alpha(1,3)-fucosyltransferase and alpha(1,4)-fucosyltransferase activities. Mutations in this gene are responsible for the majority of Lewis antigen-negative phenotypes. Differences in the expression of this gene are associated with host susceptibility to viral infection.
Clonality: Polyclonal
Molecular Weight: 42kDa
NCBI: 2525
UniProt: P21217
Purity: Affinity purification
Sequence: MDPLGAAKPQWPWRRCLAALLFQLLVAVCFFSYLRVSRDDATGSPRAPSGSSRQDTTPTRPTLLILLWTWPFHIPVALSRCSEMVPGTADCHITADRKVY
Target: FUT3
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Rat. ResearchArea: Immunology Inflammation,CDs,Cardiovascular,Blood. Shipping: Ice Bag
Western blot analysis of various lysates using FUT3 Rabbit pAb (A15058) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.