IGFBP4 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A15068
Article Name: IGFBP4 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A15068
Supplier Catalog Number: A15068
Alternative Catalog Number: ABB-A15068-20UL,ABB-A15068-100UL,ABB-A15068-500UL,ABB-A15068-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: BP-4, IBP4, IGFBP-4, HT29-IGFBP, IGFBP4
This gene is a member of the insulin-like growth factor binding protein (IGFBP) family and encodes a protein with an IGFBP domain and a thyroglobulin type-I domain. The protein binds both insulin-like growth factors (IGFs) I and II and circulates in the plasma in both glycosylated and non-glycosylated forms. Binding of this protein prolongs the half-life of the IGFs and alters their interaction with cell surface receptors.
Clonality: Polyclonal
Molecular Weight: 28kDa
NCBI: 3487
UniProt: P22692
Purity: Affinity purification
Sequence: LHRALERLAASQSRTHEDLYIIPIPNCDRNGNFHPKQCHPALDGQRGKCWCVDRKTGVKLPGGLEPKGELDCHQLADSFRE
Target: IGFBP4
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Mouse,Rat. ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Cytoskeleton,Extracellular Matrix,Bone,Growth factors,Cardiovascular,Angiogenesis. Shipping: Ice Bag
Western blot analysis of various lysates using IGFBP4 Rabbit pAb (A15068) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 15s.