ADIPOR1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A1509
Article Name: ADIPOR1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A1509
Supplier Catalog Number: A1509
Alternative Catalog Number: ABB-A1509-100UL,ABB-A1509-20UL,ABB-A1509-1000UL,ABB-A1509-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: CGI45, PAQR1, ACDCR1, CGI-45, TESBP1A, ADIPOR1
This gene encodes a protein which acts as a receptor for adiponectin, a hormone secreted by adipocytes which regulates fatty acid catabolism and glucose levels. Binding of adiponectin to the encoded protein results in activation of an AMP-activated kinase signaling pathway which affects levels of fatty acid oxidation and insulin sensitivity. A pseudogene of this gene is located on chromosome 14. Multiple alternatively spliced transcript variants have been found for this gene.
Clonality: Polyclonal
Molecular Weight: 43kDa
NCBI: 51094
UniProt: Q96A54
Purity: Affinity purification
Sequence: MSSHKGSVVAQGNGAPASNREADTVELAELGPLLEEKGKRVIANPPKAEEEQTCPVPQE
Target: ADIPOR1
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Mouse,Rat. ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Growth factors,Endocrine Metabolism,AMPK Signaling Pathway,Cardiovascular,Lipids. Shipping: Ice Bag
Western blot analysis of various lysates, using ADIPOR1 Rabbit pAb (A1509) at 1:600 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.