HEY2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A15143
Article Name: HEY2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A15143
Supplier Catalog Number: A15143
Alternative Catalog Number: ABB-A15143-20UL,ABB-A15143-100UL,ABB-A15143-1000UL,ABB-A15143-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: GRL, CHF1, HRT2, HERP1, HESR2, bHLHb32, GRIDLOCK, HEY2
This gene encodes a member of the hairy and enhancer of split-related (HESR) family of basic helix-loop-helix (bHLH)-type transcription factors. The encoded protein forms homo- or hetero-dimers that localize to the nucleus and interact with a histone deacetylase complex to repress transcription. Expression of this gene is induced by the Notch signal transduction pathway. Two similar and redundant genes in mouse are required for embryonic cardiovascular development, and are also implicated in neurogenesis and somitogenesis. Alternatively spliced transcript variants have been found, but their biological validity has not been determined.
Clonality: Polyclonal
Molecular Weight: 36kDa
NCBI: 23493
UniProt: Q9UBP5
Purity: Affinity purification
Sequence: MKRPCEETTSESDMDETIDVGSENNYSGQSTSSVIRLNSPTTTSQIMARKKRRGIIEKRRRDRINNSLSELRRLVPTAFEKQGSAKLEKAEILQMTVDHL
Target: HEY2
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Stem Cells,Cardiovascular,Heart,Cardiogenesis. Shipping: Ice Bag
Western blot analysis of various lysates, using HEY2 Rabbit pAb (A15143) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.