TAS2R10 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A15156
Article Name: TAS2R10 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A15156
Supplier Catalog Number: A15156
Alternative Catalog Number: ABB-A15156-100UL,ABB-A15156-20UL,ABB-A15156-1000UL,ABB-A15156-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: TRB2, T2R10, TAS2R10
This gene product belongs to the family of candidate taste receptors that are members of the G-protein-coupled receptor superfamily. These proteins are specifically expressed in the taste receptor cells of the tongue and palate epithelia. They are organized in the genome in clusters and are genetically linked to loci that influence bitter perception in mice and humans. In functional expression studies, they respond to bitter tastants. This gene maps to the taste receptor gene cluster on chromosome 12p13.
Clonality: Polyclonal
Molecular Weight: 35kDa
NCBI: 50839
UniProt: Q9NYW0
Purity: Affinity purification
Sequence: TSLSIFYFLKIANFSNYIFLWLKSRTNMVLPFMIVFLLISSLLNFAYIAKILNDYKTKNDTVWDLNMYKSEYFIKQILLNLGVIFFFTLSLITCIFLIISL
Target: TAS2R10
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Mouse,Rat. ResearchArea: Signal Transduction,G protein signaling,G-Protein-Coupled ReceptorsGPCR,Neuroscience. Shipping: Ice Bag
Western blot analysis of various lysates using TAS2R10 Rabbit pAb (A15156) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.