RNF125 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A15165
- Images (1)
| Article Name: | RNF125 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A15165 |
| Supplier Catalog Number: | A15165 |
| Alternative Catalog Number: | ABB-A15165-20UL,ABB-A15165-100UL,ABB-A15165-1000UL,ABB-A15165-500UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | TNORS, TRAC1, TRAC-1, RNF125 |
| This gene encodes a novel E3 ubiquitin ligase that contains a RING finger domain in the N-terminus and three zinc-binding and one ubiquitin-interacting motif in the C-terminus. As a result of myristoylation, this protein associates with membranes and is primarily localized to intracellular membrane systems. The encoded protein may function as a positive regulator in the T-cell receptor signaling pathway. |
| Clonality: | Polyclonal |
| Molecular Weight: | 26kDa |
| NCBI: | 54941 |
| UniProt: | Q96EQ8 |
| Purity: | Affinity purification |
| Sequence: | LEVLHQPVRTRCGHVFCRSCIATSLKNNKWTCPYCRAYLPSEGVPATDVAKRMKSEYKNCAECDTLVCLSEMRAHIRTCQKYIDKYGPLQELEETAARCVCPFCQRELYEDSLLDHCITHHRSERRPVFCPLCRLIPDENPSSFSGSLIRHLQVSHTLFY |
| Target: | RNF125 |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human. ResearchArea: Epigenetics Nuclear Signaling,Cell Biology Developmental Biology,Cell Cycle,Ubiquitin. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates, using RNF125 Rabbit pAb (A15165) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 60s. |
Product Guarantee and Expert Support
