STRBP Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A15169
Article Name: STRBP Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A15169
Supplier Catalog Number: A15169
Alternative Catalog Number: ABB-A15169-20UL,ABB-A15169-100UL,ABB-A15169-500UL,ABB-A15169-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: p74, SPNR, ILF3L, HEL162, STRBP
Enables RNA binding activity. Predicted to be involved in spermatogenesis. Predicted to act upstream of or within mechanosensory behavior and spermatid development. Located in nucleus.
Clonality: Polyclonal
Molecular Weight: 74kDa
NCBI: 55342
UniProt: Q96SI9
Purity: Affinity purification
Sequence: CALKHVSDWLDETNKGTKTEGETEVKKDEAGENYSKDQGGRTLCGVMRIGLVAKGLLIKDDMDLELVLMCKDKPTETLLNTVKDNLPIQIQKLTEEKYQVEQCVNEASIIIRNTKEPTLTLKVILTSPLIRDELEKKDGENVSMKDPPDLL
Target: STRBP
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human. ResearchArea: Epigenetics Nuclear Signaling,RNA Binding. Shipping: Ice Bag
Western blot analysis of lysates from HeLa cells, using STRBP Rabbit pAb (A15169) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.