TCTE1 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A15216
- Images (1)
| Article Name: | TCTE1 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A15216 |
| Supplier Catalog Number: | A15216 |
| Alternative Catalog Number: | ABB-A15216-20UL,ABB-A15216-100UL,ABB-A15216-500UL,ABB-A15216-1000UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | DRC5, D6S46, FAP155, TCTE1 |
| Predicted to be involved in flagellated sperm motility. Predicted to be located in sperm flagellum. |
| Clonality: | Polyclonal |
| Molecular Weight: | 56kDa |
| NCBI: | 202500 |
| UniProt: | Q5JU00 |
| Purity: | Affinity purification |
| Sequence: | MQDTVTTSALLDPSHSSVSTQDNSSTGGHTSSTSPQLSKPSITPVPAKSRNPHPRANIRRMRRIIAEDPEWSLAIVPLLTELCIQHIIRNFQKNPILKQMLPEHQQKVLNHLSPDLPLAVTANLIDSENYWLRCCMHRWPVCHVAHHGGSWKRMFFERHLENLLKHFIPGTTDPAVILDLLPLCRNYVRRVHVDQFLPPVQLPAQLRPGDQSDSGSEGEMEEPTVDHYQLGDLVAGLSHLEELDLVYDVKDCGMN |
| Target: | TCTE1 |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cell Biology & Developmental Biology. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using TCTE1 Rabbit pAb (A15216) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 15s. |
Product Guarantee and Expert Support
