FOXK1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A15220
Article Name: FOXK1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A15220
Supplier Catalog Number: A15220
Alternative Catalog Number: ABB-A15220-20UL,ABB-A15220-100UL,ABB-A15220-500UL,ABB-A15220-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: FOXK1L, FOXK1
Enables 14-3-3 protein binding activity, DNA-binding transcription repressor activity, RNA polymerase II-specific, and transcription cis-regulatory region binding activity. Involved in several processes, including cellular glucose homeostasis, negative regulation of autophagy, and regulation of transcription, DNA-templated. Located in cytoplasm and nucleus.
Clonality: Polyclonal
Molecular Weight: 75kDa
NCBI: 221937
UniProt: P85037
Purity: Affinity purification
Sequence: TVTILQPATPVTLGQHHLPVRAVTQNGKHAVPTNSLAGNAYALTSPLQLLATQASSSAPVVVTRVCEVGPKEPAAAVAATATTTPATATTASASASSTGEPEVKRSRVEEPSGAVTTPAGVIAAAGPQGPGTGE
Target: FOXK1
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors. Shipping: Ice Bag
Western blot analysis of lysates from U2OS cells, using FOXK1 Rabbit pAb (A15220) at 1:2000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.