UNC93B1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A15250
Article Name: UNC93B1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A15250
Supplier Catalog Number: A15250
Alternative Catalog Number: ABB-A15250-20UL,ABB-A15250-100UL,ABB-A15250-500UL,ABB-A15250-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: IIAE1, UNC93, UNC93B, Unc-93B1, UNC93B1
This gene encodes a protein that is involved in innate and adaptive immune response by regulating toll-like receptor signaling. The encoded protein traffics nucleotide sensing toll-like receptors to the endolysosome from the endoplasmic reticulum. Deficiency of the encoded protein has been associated with herpes simplex encephalitis.
Clonality: Polyclonal
Molecular Weight: 67kDa
NCBI: 81622
UniProt: Q9H1C4
Purity: Affinity purification
Sequence: KTGLSTLLGILYEDKERQDFIFTIYHWWQAVAIFTVYLGSSLHMKAKLAVLLVTLVAAAVSYLRMEQKLRRGVAPRQPRIPRPQHKVRGYRYLEEDNSDES
Target: UNC93B1
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cell Biology Developmental Biology. Shipping: Ice Bag
Western blot analysis of various lysates using UNC93B1 Rabbit pAb (A15250) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 15S.