CEBP Delta/CEBPD Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A15261
Article Name: CEBP Delta/CEBPD Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A15261
Supplier Catalog Number: A15261
Alternative Catalog Number: ABB-A15261-100UL,ABB-A15261-20UL,ABB-A15261-1000UL,ABB-A15261-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: CELF, CRP3, C/EBP-delta, NF-IL6-beta, CEBP Delta/CEBPD
The protein encoded by this intronless gene is a bZIP transcription factor which can bind as a homodimer to certain DNA regulatory regions. It can also form heterodimers with the related protein CEBP-alpha. The encoded protein is important in the regulation of genes involved in immune and inflammatory responses, and may be involved in the regulation of genes associated with activation and/or differentiation of macrophages. The cytogenetic location of this locus has been reported as both 8p11 and 8q11.
Clonality: Polyclonal
Molecular Weight: 28kDa
NCBI: 1052
UniProt: P49716
Purity: Affinity purification
Sequence: PAMYDDESAIDFSAYIDSMAAVPTLELCHDELFADLFNSNHKAGGAGPLELLPGGPARPLGPGPAAPRLLKREPDWGDGDAPGSLLPAQVAACAQTVVSLA
Target: CEBPD
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Mouse. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Endocrine Metabolism,Endocrine and metabolic diseases,Obesity,Immunology Inflammation,Cell Intrinsic Innate Immunity Signaling Pathway,Cardiovascular. Shipping: Ice Bag
Western blot analysis of various lysates using CEBP Delta/CEBPD Rabbit pAb (A15261) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.