CENPE Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A15263
- Images (1)
| Article Name: | CENPE Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A15263 |
| Supplier Catalog Number: | A15263 |
| Alternative Catalog Number: | ABB-A15263-20UL,ABB-A15263-100UL,ABB-A15263-500UL,ABB-A15263-1000UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | KIF10, CENP-E, MCPH13, PPP1R61, CENPE |
| Centrosome-associated protein E (CENPE) is a kinesin-like motor protein that accumulates in the G2 phase of the cell cycle. Unlike other centrosome-associated proteins, it is not present during interphase and first appears at the centromere region of chromosomes during prometaphase. This protein is required for stable spindle microtubule capture at kinetochores which is a necessary step in chromosome alignment during prometaphase. This protein also couples chromosome position to microtubule depolymerizing activity. Alternative splicing results in multiple transcript variants encoding distinct protein isoforms. |
| Clonality: | Polyclonal |
| Molecular Weight: | 316kDa |
| NCBI: | 1062 |
| UniProt: | Q02224 |
| Purity: | Affinity purification |
| Sequence: | ALILKSEHIRLEKEISKLKQQNEQLIKQKNELLSNNQHLSNEVKTWKERTLKREAHKQVTCENSPKSPKVTGTASKKKQITPSQCKERNLQDPVPKESPKSCFFDSRSKSLPSPHPVRYFDNSSLGLCPEVQNAGAESVDSQPGPWHASSGKDVPECKTQ |
| Target: | CENPE |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:200 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Cell Biology Developmental Biology,Cell Cycle. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using CENPE Rabbit pAb (A15263) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 90s. |
Product Guarantee and Expert Support
