PCYT2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A15309
Article Name: PCYT2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A15309
Supplier Catalog Number: A15309
Alternative Catalog Number: ABB-A15309-20UL,ABB-A15309-100UL,ABB-A15309-1000UL,ABB-A15309-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: ET, SPG82, PCYT2
This gene encodes an enzyme that catalyzes the formation of CDP-ethanolamine from CTP and phosphoethanolamine in the Kennedy pathway of phospholipid synthesis. Alternative splicing results in multiple transcript variants.
Clonality: Polyclonal
Molecular Weight: 44kDa
NCBI: 5833
UniProt: Q99447
Purity: Affinity purification
Sequence: MIRNGRGAAGGAEQPGPGGRRAVRVWCDGCYDMVHYGHSNQLRQARAMGDYLIVGVHTDEEIAKHKGPPVFTQEERYKMVQAIKWVDEVVPAAPYVTTLETLDKYNCDFCVHGNDITLTVDGRDTYEEVKQAGRYRECKRTQGVSTTDLVGRMLLVTKAHHSSQEMSSEYREYADSFGKCPGGRNPWTGVSQFLQTSQKIIQFASGKEPQPGETVIYVAGAFDLFHIGHVDFLEKVHRLAERPYIIAGLHFDQEV
Target: PCYT2
Antibody Type: Primary Antibody
Application Dilute: WB,1:200 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Endocrine Metabolism,Immunology Inflammation,Cell Intrinsic Innate Immunity Signaling Pathway,Neuroscience,Neurodegenerative Diseases,Amyloid Plaque and Neurofibrillary Tangle Formation in Alzheimers Disease,Cardiovascular,Lipids,Fatty Acids. Shipping: Ice Bag
Western blot analysis of various lysates using PCYT2 Rabbit pAb (A15309) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.