XPNPEP1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A15327
Article Name: XPNPEP1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A15327
Supplier Catalog Number: A15327
Alternative Catalog Number: ABB-A15327-100UL,ABB-A15327-20UL,ABB-A15327-1000UL,ABB-A15327-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: APP1, SAMP, XPNPEP, XPNPEPL, XPNPEPL1, XPNPEP1
This gene encodes the cytosolic form of a metalloaminopeptidase that catalyzes the cleavage of the N-terminal amino acid adjacent to a proline residue. The gene product may play a role in degradation and maturation of tachykinins, neuropeptides, and peptide hormones. Alternative splicing results in multiple transcript variants.
Clonality: Polyclonal
Molecular Weight: 70kDa
NCBI: 7511
UniProt: Q9NQW7
Purity: Affinity purification
Sequence: MPPKVTSELLRQLRQAMRNSEYVTEPIQAYIIPSGDAHQSEYIAPCDCRRAFVSGFDGSAGTAIITEEHAAMWTDGRYFLQAAKQMDSNWTLMKMGLKDTPTQEDWLVSVLPEGSRVGVDPLIIPTDYWKKMAKVLRSAGHHLIPVKENLVDKIWTDRPERPCKPLLTLGLDYTGISWKDKVADLRLKMAERNVMWF
Target: XPNPEP1
Antibody Type: Primary Antibody
Application Dilute: WB,1:200 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse. ResearchArea: Cancer,Signal Transduction,Endocrine Metabolism,Amino acid metabolism. Shipping: Ice Bag
Western blot analysis of various lysates using XPNPEP1 Rabbit pAb (A15327) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.