ZNF23 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A15329
- Images (1)
| Article Name: | ZNF23 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A15329 |
| Supplier Catalog Number: | A15329 |
| Alternative Catalog Number: | ABB-A15329-20UL,ABB-A15329-100UL,ABB-A15329-500UL,ABB-A15329-1000UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | KOX16, ZNF359, ZNF612, Zfp612, ZNF23 |
| Enables sequence-specific double-stranded DNA binding activity. Predicted to be involved in regulation of transcription by RNA polymerase II. Predicted to be active in nucleus. |
| Clonality: | Polyclonal |
| Molecular Weight: | 73kDa |
| NCBI: | 7571 |
| UniProt: | P17027 |
| Purity: | Affinity purification |
| Sequence: | MLENYGNVASLGFPLLKPAVISQLEGGSELGGSSPLAAGTGLQGLQTDIQTDNDLTKEMYEGKENVSFELQRDFSQETDFSEASLLEKQQEVHSAGNIKKEKSNTIDGTVKDETSPVEECFFSQSSNSYQCHTITGEQPSGCTGLGKSISFDTKLVKHEIINSEERPFKCEELVEPFRCDSQLIQHQENNTEEKPYQCSECGKAFSINEKLIWHQRLHSG |
| Target: | ZNF23 |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:200 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human,Mouse. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Cancer,Tumor biomarkers,Cell Biology Developmental Biology,Apoptosis. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using ZNF23 Rabbit pAb (A15329) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 10s. |
Product Guarantee and Expert Support
