FIG4 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A15372
- Images (1)
| Article Name: | FIG4 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A15372 |
| Supplier Catalog Number: | A15372 |
| Alternative Catalog Number: | ABB-A15372-100UL,ABB-A15372-20UL,ABB-A15372-500UL,ABB-A15372-1000UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | BOP, YVS, BTOP, SAC3, ALS11, CMT4J, KIAA0274, dJ249I4.1, FIG4 |
| The protein encoded by this gene belongs to the SAC domain-containing protein gene family. The SAC domain, approximately 400 amino acids in length and consisting of seven conserved motifs, has been shown to possess phosphoinositide phosphatase activity. The yeast homolog, Sac1p, is involved in the regulation of various phosphoinositides, and affects diverse cellular functions such as actin cytoskeleton organization, Golgi function, and maintenance of vacuole morphology. Membrane-bound phosphoinositides function as signaling molecules and play a key role in vesicle trafficking in eukaryotic cells. Mutations in this gene have been associated with Charcot-Marie-Tooth disease, type 4J. |
| Clonality: | Polyclonal |
| Molecular Weight: | 104kDa |
| NCBI: | 9896 |
| UniProt: | Q92562 |
| Purity: | Affinity purification |
| Sequence: | WELPTDFYLHHKNTMRLLPTRRSYTYWWTPEVIKHLPLPYDEVICAVNLKKLIVKKFHKYEEEIDIHNEFFRPYELSSFDDTFCLAMTSSARDFMPKTVGIDPSPFTVRKPDETGKSVLGNKSNREEAVLQRKTAASAPPPPSEEAVSSSSEDDSGTDREEEGSVSQRSTPVKMTDAGDSAKVTENVVQPMKELYGINLSDGLSEEDFSIYSRFVQLGQSQHKQDKNSQQPCSRCSDGVIKLTPISAFSQDNIYE |
| Target: | FIG4 |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:200 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human,Mouse. ResearchArea: Signal Transduction,Neuroscience,Neurodegenerative Diseases,Other Neurological disorders. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using FIG4 Rabbit pAb (A15372) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 30s. |
Product Guarantee and Expert Support
