EDC4 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A15418
- Images (1)
| Article Name: | EDC4 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A15418 |
| Supplier Catalog Number: | A15418 |
| Alternative Catalog Number: | ABB-A15418-20UL,ABB-A15418-100UL,ABB-A15418-1000UL,ABB-A15418-500UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | GE1, Ge-1, RCD8, HEDL5, HEDLS, RCD-8, EDC4 |
| Predicted to be involved in deadenylation-independent decapping of nuclear-transcribed mRNA. Located in P-body and nucleoplasm. |
| Clonality: | Polyclonal |
| Molecular Weight: | 152kDa |
| NCBI: | 23644 |
| UniProt: | Q6P2E9 |
| Purity: | Affinity purification |
| Sequence: | GDGDRHNTPSLLEAALTQEASTPDSQVWPTAPDITRETCSTLAESPRNGLQEKHKSLAFHRPPYHLLQQRDSQDASAEQSDHDDEVASLASASGGFGTKVPAPRLPAKDWKTKGSPRTSPKLKRKSKKDDGDAAMGSRLTEHQVAEPPEDWPALIWQQQRELAELRHSQEELLQRLCTQLEGLQSTVTGHVERALETRHEQEQRRLERALAEGQQRGGQLQEQLTQQLSQALSSAVAGRLERSIRDEIKKTVPPC |
| Target: | EDC4 |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:200 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human,Mouse. ResearchArea: Epigenetics Nuclear Signaling. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using EDC4 Rabbit pAb (A15418) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit (RM00021). Exposure time: 30s. |
Product Guarantee and Expert Support
