PXK Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A15458
Article Name: PXK Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A15458
Supplier Catalog Number: A15458
Alternative Catalog Number: ABB-A15458-20UL,ABB-A15458-100UL,ABB-A15458-1000UL,ABB-A15458-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: SLOB, MONAKA, PXK
This gene encodes a phox (PX) domain-containing protein which may be involved in synaptic transmission and the ligand-induced internalization and degradation of epidermal growth factors. Variations in this gene may be associated with susceptibility to systemic lupus erythematosus (SLE). Alternative splicing results in multiple transcript variants.
Clonality: Polyclonal
Molecular Weight: 65kDa
NCBI: 54899
UniProt: Q7Z7A4
Purity: Affinity purification
Sequence: MAFMEKPPAGKVLLDDTVPLTAAIEASQSLQSHTEYIIRVQRGISVENSWQIVRRYSDFDLLNNSLQIAGLSLPLPPKKLIGNMDREFIAERQKGLQNYLNVITTNHILSNCELVKKFLDPNNYSANYTEIALQQVSMFFRSEPKWEVVEPLKDIGWRIRKKYFLMKIKNQPKERLVLSWADLGPDKYLSDKDFQCLIKL
Target: PXK
Antibody Type: Primary Antibody
Application Dilute: WB,1:200 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Endocrine Metabolism,Immunology Inflammation. Shipping: Ice Bag
Western blot analysis of various lysates using PXK Rabbit pAb (A15458) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.