DCAF11 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A15519
- Images (1)
| Article Name: | DCAF11 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A15519 |
| Supplier Catalog Number: | A15519 |
| Alternative Catalog Number: | ABB-A15519-20UL,ABB-A15519-100UL,ABB-A15519-500UL,ABB-A15519-1000UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | GL014, WDR23, PRO2389, DCAF11 |
| This gene encodes a WD repeat-containing protein that interacts with the COP9 signalosome, a macromolecular complex that interacts with cullin-RING E3 ligases and regulates their activity by hydrolyzing cullin-Nedd8 conjugates. Multiple alternatively spliced transcript variants have been found for this gene. |
| Clonality: | Polyclonal |
| Molecular Weight: | 62kDa |
| NCBI: | 80344 |
| UniProt: | Q8TEB1 |
| Purity: | Affinity purification |
| Sequence: | MGSRNSSSAGSGSGDPSEGLPRRGAGLRRSEEEEEEDEDVDLAQVLAYLLRRGQVRLVQGGGAANLQFIQALLDSEEENDRAWDGRLGDRYNPPVDATPDTRELEFNEIKTQVELATGQLGLRRAAQKHSFPRMLHQRERGLCHRGSFSLGEQSRVISHFLPNDLGFTDS |
| Target: | DCAF11 |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:1000 - 1:5000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cell Biology Developmental Biology,Ubiquitin. Shipping: Ice Bag |
|
|
Western blot analysis of lysates from Mouse liver, using DCAF11 Rabbit pAb (A15519) at 1:2000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 20s. |
Product Guarantee and Expert Support
