FLYWCH2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A15556
Article Name: FLYWCH2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A15556
Supplier Catalog Number: A15556
Alternative Catalog Number: ABB-A15556-100UL,ABB-A15556-20UL,ABB-A15556-1000UL,ABB-A15556-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: FLYWCH2
Enables RNA binding activity.
Clonality: Polyclonal
Molecular Weight: 15kDa
NCBI: 114984
UniProt: Q96CP2
Purity: Affinity purification
Sequence: STKVAGAKRKGVHCVMSLGVPGPATLAKALLQTHPEAQRAIEAAPQEPEQKRSRQDPGTDRTEDSGLAAGPPEAAGENFAPCSVAPGKSL
Target: FLYWCH2
Antibody Type: Primary Antibody
Application Dilute: WB,1:200 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human. ResearchArea: Epigenetics Nuclear Signaling,RNA Binding,Cell Biology Developmental Biology. Shipping: Ice Bag
Western blot analysis of various lysates using FLYWCH2 Rabbit pAb (A15556) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.