CD163L1 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A15578
- Images (1)
| Article Name: | CD163L1 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A15578 |
| Supplier Catalog Number: | A15578 |
| Alternative Catalog Number: | ABB-A15578-100UL,ABB-A15578-20UL,ABB-A15578-500UL,ABB-A15578-1000UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | WC1, M160, STAR, CD163B, SCARI2, CD163L1 |
| This gene encodes a member of the scavenger receptor cysteine-rich (SRCR) superfamily. Members of this family are secreted or membrane-anchored proteins mainly found in cells associated with the immune system. The SRCR family is defined by a 100-110 amino acid SRCR domain, which may mediate protein-protein interaction and ligand binding. The encoded protein contains twelve SRCR domains, a transmembrane region and a cytoplasmic domain. Alternative splicing results in multiple transcript variants encoding different isoforms. |
| Clonality: | Polyclonal |
| Molecular Weight: | 159kDa |
| NCBI: | 283316 |
| UniProt: | Q9NR16 |
| Purity: | Affinity purification |
| Sequence: | DCLHQNDVSVICSDGADLELRLADGSNNCSGRVEVRIHEQWWTICDQNWKNEQALVVCKQLGCPFSVFGSRRAKPSNEARDIWINSISCTGNESALWDCTYDGKAKRTCFRRSDAGVICSDKADLDLRLVGAHSPCYGRLEVKYQGEWGTVCHDRWSTRNAAVVCKQLGCGKPMHVFGMTYFKEASGPIWLDDVSCIGNES |
| Target: | CD163L1 |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:200 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Rat. ResearchArea: Immunology Inflammation,CDs. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using CD163L1 Rabbit pAb (A15578) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 10s. |
Product Guarantee and Expert Support
