TRAF7 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A15607
- Images (1)
| Article Name: | TRAF7 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A15607 |
| Supplier Catalog Number: | A15607 |
| Alternative Catalog Number: | ABB-A15607-20UL,ABB-A15607-100UL,ABB-A15607-500UL,ABB-A15607-1000UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | RFWD1, RNF119, CAFDADD, TRAF7 |
| Tumor necrosis factor (TNF, see MIM 191160) receptor-associated factors, such as TRAF7, are signal transducers for members of the TNF receptor superfamily (see MIM 191190). TRAFs are composed of an N-terminal cysteine/histidine-rich region containing zinc RING and/or zinc finger motifs, a coiled-coil (leucine zipper) motif, and a homologous region that defines the TRAF family, the TRAF domain, which is involved in self-association and receptor binding. |
| Clonality: | Polyclonal |
| Molecular Weight: | 75kDa |
| NCBI: | 84231 |
| UniProt: | Q6Q0C0 |
| Purity: | Affinity purification |
| Sequence: | PHSKYGCTFIGNQDTYETHLETCRFEGLKEFLQQTDDRFHEMHVALAQKDQEIAFLRSMLGKLSEKIDQLEKSLELKFDVLDENQSKLSEDLMEFRRDASMLNDELSHINARLNMGILGSYDPQQIFKCKGTFVGHQGPVW |
| Target: | TRAF7 |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human. ResearchArea: Cell Biology Developmental Biology,Apoptosis,Ubiquitin,Immunology Inflammation,Cytokines,Cell Intrinsic Innate Immunity Signaling Pathway. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using TRAF7 Rabbit pAb (A15607) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 15s. |
Product Guarantee and Expert Support
