FNTB Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A15671
Article Name: FNTB Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A15671
Supplier Catalog Number: A15671
Alternative Catalog Number: ABB-A15671-20UL,ABB-A15671-100UL,ABB-A15671-1000UL,ABB-A15671-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: FPTB, FNTB
Enables zinc ion binding activity. Contributes to protein farnesyltransferase activity. Involved in protein farnesylation. Part of microtubule associated complex and protein farnesyltransferase complex.
Clonality: Polyclonal
Molecular Weight: 49kDa
NCBI: 2342
UniProt: P49356
Purity: Affinity purification
Sequence: MASPSSFTYYCPPSSSPVWSEPLYSLRPEHARERLQDDSVETVTSIEQAKVEEKIQEVFSSYKFNHLVPRLVLQREKHFHYLKRGLRQLTDAYECLDASRPWLCYWILHSLELLDEPIPQ
Target: FNTB
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Endocrine Metabolism,Amino acid metabolism. Shipping: Ice Bag
Western blot analysis of various lysates using FNTB Rabbit pAb (A15671) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 15s.