AURKA Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A15728
Article Name: AURKA Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A15728
Supplier Catalog Number: A15728
Alternative Catalog Number: ABB-A15728-100UL,ABB-A15728-20UL,ABB-A15728-500UL,ABB-A15728-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: AIK, ARK1, AURA, BTAK, STK6, STK7, STK15, PPP1R47, AURKA
The protein encoded by this gene is a cell cycle-regulated kinase that appears to be involved in microtubule formation and/or stabilization at the spindle pole during chromosome segregation. The encoded protein is found at the centrosome in interphase cells and at the spindle poles in mitosis. This gene may play a role in tumor development and progression. A processed pseudogene of this gene has been found on chromosome 1, and an unprocessed pseudogene has been found on chromosome 10. Multiple transcript variants encoding the same protein have been found for this gene.
Clonality: Polyclonal
Molecular Weight: 46kDa
NCBI: 6790
UniProt: O14965
Purity: Affinity purification
Sequence: MDRSKENCISGPVKATAPVGGPKRVLVTQQFPCQNPLPVNSGQAQRVLCPSNSSQRIPLQAQKLVSSHKPVQNQKQKQLQATSVPHPVSRPLNNTQKSKQPLPSAPENNPEEELASKQKNEESKKRQWAL
Target: AURKA
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human. ResearchArea: Epigenetics Nuclear Signaling,Protein phosphorylation,Cancer,Tumor biomarkers,Signal Transduction,Kinase,Serine threonine kinases,Cell Biology Developmental Biology,Cell Cycle,Centrosome,Cell Cycle Control-G2 M DNA Damage Checkpoint. Shipping: Ice Bag
Western blot analysis of various lysates using AURKA Rabbit pAb (A15728) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.