ZNF134 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A15739
Article Name: ZNF134 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A15739
Supplier Catalog Number: A15739
Alternative Catalog Number: ABB-A15739-20UL,ABB-A15739-100UL,ABB-A15739-500UL,ABB-A15739-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: pHZ-15, ZNF134
Predicted to enable DNA-binding transcription repressor activity, RNA polymerase II-specific and RNA polymerase II cis-regulatory region sequence-specific DNA binding activity. Predicted to be involved in regulation of transcription by RNA polymerase II. Predicted to be active in nucleoplasm.
Clonality: Polyclonal
Molecular Weight: 48kDa
NCBI: 7693
UniProt: P52741
Purity: Affinity purification
Sequence: HGLKLHTCGACGRQFWFSANLHQYQKCYSIEQPLRRDKSEASIVKNCTVSKEPHPSEKPFTCKEEQKNFQATLGGCQQKAIHSKRKTHRSTESGDAFH
Target: ZNF134
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors. Shipping: Ice Bag
Western blot analysis of various lysates, using ZNF134 Rabbit pAb (A15739) at 1:400 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.