MPHOSPH6 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A15775
Article Name: MPHOSPH6 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A15775
Supplier Catalog Number: A15775
Alternative Catalog Number: ABB-A15775-100UL,ABB-A15775-20UL,ABB-A15775-500UL,ABB-A15775-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: MPP, MPP6, MPP-6, MPHOSPH6
Predicted to enable RNA binding activity. Involved in maturation of 5.8S rRNA. Located in cytosol, nucleolus, and nucleoplasm. Colocalizes with nuclear exosome (RNase complex).
Clonality: Polyclonal
Molecular Weight: 19kDa
NCBI: 10200
UniProt: Q99547
Purity: Affinity purification
Sequence: MAAERKTRLSKNLLRMKFMQRGLDSETKKQLEEEEKKIISEEHWYLDLPELKEKESFIIEEQSFLLCEDLLYGRMSFRGFNPEVEKLMLQMNAKHKAEEVEDETVELDVSDEEMARRYETLVGTIGKKFARKRDHANYEEDENGDITPIKAKKMFLKPQD
Target: MPHOSPH6
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Cell Biology Developmental Biology,Cell Cycle. Shipping: Ice Bag
Western blot analysis of various lysates using MPHOSPH6 Rabbit pAb (A15775) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.