SR-BI Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A1584
Article Name: SR-BI Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A1584
Supplier Catalog Number: A1584
Alternative Catalog Number: ABB-A1584-100UL,ABB-A1584-20UL,ABB-A1584-1000UL,ABB-A1584-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: CLA1, SRB1, CLA-1, SR-BI, CD36L1, HDLCQ6, HDLQTL6
The protein encoded by this gene is a plasma membrane receptor for high density lipoprotein cholesterol (HDL). The encoded protein mediates cholesterol transfer to and from HDL. In addition, this protein is a receptor for hepatitis C virus glycoprotein E2 and facilitates cell entry by the virus, SARS-CoV2.
Clonality: Polyclonal
Molecular Weight: 61kDa
NCBI: 949
UniProt: Q8WTV0
Purity: Affinity purification
Sequence: MGCSAKARWAAGALGVAGLLCAVLGAVMIVMVPSLIKQQVLKNVRIDPSSLSFNMWKEIPIPFYLSVYFFDVMNPSEILKGEKPQVRERGPYVYREFRHK
Target: SCARB1
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Signal Transduction,Endocrine Metabolism,Lipid Metabolism,Cholesterol Metabolism,Cardiovascular,Lipids. Shipping: Ice Bag
Western blot analysis of various lysates using SR-BI Rabbit pAb (A1584) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.