OXSM Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A15852
- Images (1)
| Article Name: | OXSM Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A15852 |
| Supplier Catalog Number: | A15852 |
| Alternative Catalog Number: | ABB-A15852-100UL,ABB-A15852-20UL,ABB-A15852-500UL,ABB-A15852-1000UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | KS, CEM1, KASI, FASN2D, OXSM |
| This gene encodes a beta-ketoacyl synthetase. The encoded enzyme is required for elongation of fatty acid chains in the mitochondria. Alternatively spliced transcript variants have been described. |
| Clonality: | Polyclonal |
| Molecular Weight: | 49kDa |
| NCBI: | 54995 |
| UniProt: | Q9NWU1 |
| Purity: | Affinity purification |
| Sequence: | EYKSIPCSVAAYVPRGSDEGQFNEQNFVSKSDIKSMSSPTIMAIGAAELAMKDSGWHPQSEADQVATGVAIGMGMIPLEVVSETALNFQTKGYNKVSPFFVPKILVNMAAGQVSIRYKLKGPNHAVSTACTTGAHAVGDSFRFIAHGDADVMVAGGTDSCISPLSLAGFSRARALSTNSDPKLACRPFHPKRDGFVMGEGAAVLVLEEYEHAVQRRARIYAEVLGYGLSGDAGHITAPDPEGEGALRCMAAALKD |
| Target: | OXSM |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Endocrine Metabolism,Mitochondrial metabolism,Mitochondrial markers,Lipid Metabolism,Cardiovascular,Lipids,Fatty Acids. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using OXSM Rabbit pAb (A15852) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 10s. |
Product Guarantee and Expert Support
