ATP10A Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A15873
- Images (1)
| Article Name: | ATP10A Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A15873 |
| Supplier Catalog Number: | A15873 |
| Alternative Catalog Number: | ABB-A15873-20UL,ABB-A15873-100UL,ABB-A15873-500UL,ABB-A15873-1000UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | ATPVA, ATPVC, ATP10C, ATP10A |
| The protein encoded by this gene belongs to the family of P-type cation transport ATPases, and to the subfamily of aminophospholipid-transporting ATPases. The aminophospholipid translocases transport phosphatidylserine and phosphatidylethanolamine from one side of a bilayer to another. This gene is maternally expressed. It maps within the most common interval of deletion responsible for Angelman syndrome, also known as happy puppet syndrome. |
| Clonality: | Polyclonal |
| Molecular Weight: | 168kDa |
| NCBI: | 57194 |
| UniProt: | O60312 |
| Purity: | Affinity purification |
| Sequence: | RRCTVSGVEYSHDANAQRLARYQEADSEEEEVVPRGGSVSQRGSIGSHQSVRVVHRTQSTKSHRRTGSRAEAKRASMLSKHTAFSSPMEKDITPDPKLLEKVSECDKSLAVARHQEHLLAHLSPELSDVFDFFIALTICNTVVVTSPDQPRTKVRVRFELKSPVKTIEDFLRRFTPSCLTSGCSSIGSLAANKSSHKLGSSFPSTPSSDGMLLRLEERLGQPTSAIASNGYSSQADNWASELAQEQESERE |
| Target: | ATP10A |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human. ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Endocrine Metabolism,Lipid Metabolism,Neuroscience,Neurodegenerative Diseases. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using ATP10A Rabbit pAb (A15873) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 30s. |
Product Guarantee and Expert Support
