CYB5B Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A15900
Article Name: CYB5B Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A15900
Supplier Catalog Number: A15900
Alternative Catalog Number: ABB-A15900-100UL,ABB-A15900-20UL,ABB-A15900-500UL,ABB-A15900-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: OMB5, CYB5-M, CYPB5M, CYB5B
Enables heme binding activity. Contributes to nitrite reductase (NO-forming) activity. Involved in nitric oxide biosynthetic process. Located in membrane. Part of nitric-oxide synthase complex.
Clonality: Polyclonal
Molecular Weight: 17kDa
NCBI: 80777
UniProt: O43169
Purity: Affinity purification
Sequence: KGQEVETSVTYYRLEEVAKRNSLKELWLVIHGRVYDVTRFLNEHPGGEEVLLEQAGVDASESFEDVGHSSDAREMLKQYYIGDIHPSDLKPESGSKDPSKNDTCKSCWAYWILPIIGAVLLGFLYRYYTSESKSS
Target: CYB5B
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse. ResearchArea: Cancer,Signal Transduction,Endocrine Metabolism,Mitochondrial metabolism,Mitochondrial markers. Shipping: Ice Bag
Western blot analysis of various lysates using CYB5B Rabbit pAb (A15900) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.