ITFG1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A15901
Article Name: ITFG1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A15901
Supplier Catalog Number: A15901
Alternative Catalog Number: ABB-A15901-20UL,ABB-A15901-100UL,ABB-A15901-500UL,ABB-A15901-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: TIP, CDA08, LNKN-1, 2310047C21Rik, ITFG1
Located in extracellular exosome.
Clonality: Polyclonal
Molecular Weight: 68kDa
NCBI: 81533
UniProt: Q8TB96
Purity: Affinity purification
Sequence: LWGFVPFVDEQQPTEIPIPITLHIGDYNMDGYPDALVILKNTSGSNQQAFLLENVPCNNASCEEARRMFKVYWELTDLNQIKDAMVATFFDIYEDGILDIVVLSKGYTKNDFAIHTLKNNFEADAYFVKVIVLSGLCSNDCPRKITPFGVNQPGPYIMYTTVDANGYLKNGSAGQLSQSAHLALQLPYNVLGLGRSANFLDHLYVGIPRPSGEKSIRKQEWTAIIPNSQLIVIPYPHNVPRSWSAKLYLTPSNIV
Target: ITFG1
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Immunology Inflammation. Shipping: Ice Bag
Western blot analysis of various lysates using ITFG1 Rabbit pAb (A15901) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.