NAXE Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A15952
Article Name: NAXE Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A15952
Supplier Catalog Number: A15952
Alternative Catalog Number: ABB-A15952-20UL,ABB-A15952-100UL,ABB-A15952-1000UL,ABB-A15952-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: AIBP, PEBEL, YJEFN1, APOA1BP, NAXE
The product of this gene interacts with apolipoprotein A-I (apoA-I), the major apolipoprotein of high-density lipoproteins (HDLs). It is secreted into some bodily fluids, and its synthesis and secretion are stimulated in vitro by incubating cells with apoA-I. The human genome contains related pseudogenes.
Clonality: Polyclonal
Molecular Weight: 32kDa
NCBI: 128240
UniProt: Q8NCW5
Purity: Affinity purification
Sequence: DSEVMASTVVKYLSQEEAQAVDQELFNEYQFSVDQLMELAGLSCATAIAKAYPPTSMSRSPPTVLVICGPGNNGGDGLVCARHLKLFGYEPTIYYPKRPNKPLFTALVTQCQKMDIPFLGEMP
Target: NAXE
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cardiovascular,Lipids. Shipping: Ice Bag
Western blot analysis of various lysates using NAXE Rabbit pAb (A15952) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.