ACMSD Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A15953
- Images (1)
| Article Name: | ACMSD Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A15953 |
| Supplier Catalog Number: | A15953 |
| Alternative Catalog Number: | ABB-A15953-20UL,ABB-A15953-100UL,ABB-A15953-500UL,ABB-A15953-1000UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | ACMSD |
| The neuronal excitotoxin quinolinate is an intermediate in the de novo synthesis pathway of NAD from tryptophan, and has been implicated in the pathogenesis of several neurodegenerative disorders. Quinolinate is derived from alpha-amino-beta-carboxy-muconate-epsilon-semialdehyde (ACMS). ACMSD (ACMS decarboxylase, EC 4.1.1.45) can divert ACMS to a benign catabolite and thus prevent the accumulation of quinolinate from ACMS. |
| Clonality: | Polyclonal |
| Molecular Weight: | 38kDa |
| NCBI: | 130013 |
| UniProt: | Q8TDX5 |
| Purity: | Affinity purification |
| Sequence: | MKIDIHSHILPKEWPDLKKRFGYGGWVQLQHHSKGEAKLLKDGKVFRVVRENCWDPEVRIREMDQKGVTVQALSTVPVMFSYWAKPEDTLNLCQLLNNDLASTVVSYPRRFVGLGTLPMQAPELAVKEMERCVKELGFPGVQIGTHVNEWDLNAQELFPVYAAAERLKCSLFVHPWDMQMDGRMAKYWLPWLVGMPAETTIAICSMIMGGVFEKFPKLKVCFAHGGGAFPFTVGRISHGFSMRPDLCAQDNPMNP |
| Target: | ACMSD |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Mouse,Rat. ResearchArea: Cancer,Endocrine Metabolism,Amino acid metabolism. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using ACMSD Rabbit pAb (A15953) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 10s. |
Product Guarantee and Expert Support
