SSC4D Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A15957
Article Name: SSC4D Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A15957
Supplier Catalog Number: A15957
Alternative Catalog Number: ABB-A15957-20UL,ABB-A15957-100UL,ABB-A15957-500UL,ABB-A15957-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: SRCRB4D, S4D-SRCRB, SRCRB-S4D, SSC4D
The scavenger receptor cysteine-rich (SRCR) superfamily is an ancient and highly conserved group of cell surface and/or secreted proteins, some of which are involved in the development of the immune system and the regulation of both innate and adaptive immune responses. Group B SRCR domains usually contain 8 regularly spaced cysteines that give rise to a well-defined intradomain disulfide-bond pattern.
Clonality: Polyclonal
Molecular Weight: 61kDa
NCBI: 136853
UniProt: Q8WTU2
Purity: Affinity purification
Sequence: PEELGLQVQQDGSETTRVPTPRPRDGHLRLVNGAHRCEGRVELYLGQRWGTVCDDAWDLRAAGVLCRQLGCGQALAAPGEAHFGPGRGPILLDNVKCRGEESALLLCSHIRWDAHNCDHSEDASVLCQPS
Target: SSC4D
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cell Biology & Developmental Biology. Shipping: Ice Bag
Western blot analysis of various lysates using SSC4D Rabbit pAb (A15957) at 1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.